PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_73502g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 327aa    MW: 37232.7 Da    PI: 5.0704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_73502g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.4e-152267146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+WT eEd +l ++++++G g+W+ +a+  g++Rt+ +c++rw +
    MA_73502g0010 22 KGPWTVEEDMQLTEYIRLHGEGRWSFVAKGAGLKRTGRSCRLRWVN 67
                     79******************************************87 PP

2Myb_DNA-binding44.24.4e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r + T+eE+ l+++++ ++G++ W+ Iar ++ gRt+++ k++w++
    MA_73502g0010  75 RSKITPEEERLIIELHDRWGNR-WSHIARSLP-GRTDNETKNYWRT 118
                      6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3641769IPR017930Myb domain
SuperFamilySSF466894.67E-2921116IPR009057Homeodomain-like
SMARTSM007172.0E-142171IPR001005SANT/Myb domain
PfamPF002496.8E-142267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-222376IPR009057Homeodomain-like
CDDcd001677.11E-112469No hitNo description
PROSITE profilePS5129422.33670124IPR017930Myb domain
SMARTSM007177.2E-1374122IPR001005SANT/Myb domain
PfamPF002492.5E-1276118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2177124IPR009057Homeodomain-like
CDDcd001677.93E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MATRTWSGAS GVEDEDEDET RKGPWTVEED MQLTEYIRLH GEGRWSFVAK GAGLKRTGRS  60
CRLRWVNSLR PGLKRSKITP EEERLIIELH DRWGNRWSHI ARSLPGRTDN ETKNYWRTRI  120
KGKLNLQVQS GSRGKDVDNR VHFERSLRSD CLPTSSQRPP DHDGAEPLTS FPTQGTEDAA  180
VQINKTQYLQ DDISPQVIPI HEVNDEYVLQ GETRHGPQTN DDGQPGAVSQ QDLKDSENQV  240
FENNSPYIFP VRSLASPLYS SEYCEDGASQ GGIILPSSSY MVASPEAFSD SEAYSNHYSD  300
VFWSMDEEDD RFNGRKQSVS RNDRRSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26221257109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QR051e-54A0A0D6QR05_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-51myb domain protein 79